Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180446

Catalog No. NBP180446

Description

Heterogeneous Nuclear Ribonucleoprotein (A1-like) Polyclonal specifically detects Heterogeneous Nuclear Ribonucleoprotein (A1-like) in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Heterogeneous Nuclear Ribonucleoprotein (A1-like)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: heterogeneous nuclear ribonucleoprotein A1-like 2, hnRNP A1-like 2, hnRNP core protein A1-like 2, HNRNPA1L, LOC144983, MGC102957
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 144983
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_001011724
• Gene Symbols: HNRNPA1L2
• Immunogen: Synthetic peptide directed towards the N terminal of human RP11-78J21. 1. Peptide sequence MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chimpanzee: 100%; Equine: 100%; Chicken: 100%; Crab-eating macaque: 100%; Rhesus macaque: 100%; Pig: 100%; Mouse: 100%; Canine: 100%; Bovine: 100%; Rat: 100%; Zebrafish: 92%; Western clawed frog: 92%; Green puffer: 92%; Japanese pufferfish: 92%; Xenopus: 92%; Atlantic salmon: 92%; Burton's mouthbrooder: 92%; Greater Equineshoe bat: 85%; Human: 100%; Sumatran orangutan: 84%; American grasshopper: 83%; Body louse: 81%; Rainbow trout: 76%; Fission yeast: 76%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only