Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEY1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | HEY1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HEY1 Polyclonal specifically detects HEY1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
HEY1 | |
Polyclonal | |
Rabbit | |
DNA Repair, DNA replication Transcription Translation and Splicing, Neuroscience, Transcription Factors and Regulators | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
23462 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKR | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
basic helix-loop-helix protein OAF1, BHLHb31, Cardiovascular helix-loop-helix factor 2, CHF-2, CHF2hHRT1, Class B basic helix-loop-helix protein 31, Hairy and enhancer of split-related protein 1, hairy/enhancer-of-split related with YRPW motif 1, hairy/enhancer-of-split related with YRPW motif protein 1, Hairy-related transcription factor 1, HERP2HES-related repressor protein 1, HESR-1, HESR1MGC1274, HES-related repressor protein 2, HRT1, HRT-1OAF1 | |
HEY1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title