HHAT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169465

Catalog No. NBP169465

Description

HHAT Polyclonal specifically detects HHAT in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HHAT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.3.1.-, FLJ10724, FLJ34867, GUP2, hedgehog acyltransferaserasp, MART-2, MART2sit, melanoma antigen recognized by T cells 2, Melanoma antigen recognized by T-cells 2, protein-cysteine N-palmitoyltransferase HHAT, SKI1ski, Skinny hedgehog protein 1, Skn
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Canine: 79%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5VTY9
• Gene Symbols: HHAT
• Immunogen: Synthetic peptides corresponding to HHAT(hedgehog acyltransferase) The peptide sequence was selected from the N terminal of human HHAT (NP_060664). Peptide sequence MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55733
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only