Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HIF-2 alpha/EPAS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP27656425UL
Description
HIF-2 alpha/EPAS1 Polyclonal specifically detects HIF-2 alpha/EPAS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
HIF-2 alpha/EPAS1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
Basic-helix-loop-helix-PAS protein MOP2, BHLHE73, Class E basic helix-loop-helix protein 73, ECYT4, endothelial PAS domain protein 1, endothelial PAS domain-containing protein 1, EPAS1, EPAS-1, HIF-1-alpha-like factor, HIF-1alpha-like factor, HIF-2 alpha, | |
Rabbit | |
96.5 kDa | |
25 μL | |
Angiogenesis, Apoptosis, Cancer, Cancer Stem Cells, Chromatin Research, Embryonic Stem Cell Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Transcription Factors and Regulators | |
2034.0 | |
Human | |
Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
EPAS1 | |
This HIF-2 alpha/EPAS1 Antibody was developed against Recombinant Protein corresponding to amino acids: EDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPP | |
Affinity Purified | |
RUO | |
Primary | |
The specificity of this HIF-2 alpha/EPAS1 Antibody was verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction