HIF-2 alpha/EPAS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP276564

Catalog No. NBP276564

Description

HIF-2 alpha/EPAS1 Polyclonal specifically detects HIF-2 alpha/EPAS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: HIF-2 alpha/EPAS1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
• Gene Alias: Basic-helix-loop-helix-PAS protein MOP2, BHLHE73, Class E basic helix-loop-helix protein 73, ECYT4, endothelial PAS domain protein 1, endothelial PAS domain-containing protein 1, EPAS1, EPAS-1, HIF-1-alpha-like factor, HIF-1alpha-like factor, HIF-2 alpha,
• Host Species: Rabbit
• Molecular Weight of Antigen: 96.5 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: The specificity of this HIF-2 alpha/EPAS1 Antibody was verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: EPAS1
• Immunogen: This HIF-2 alpha/EPAS1 Antibody was developed against Recombinant Protein corresponding to amino acids: EDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPP
• Purification Method: Affinity Purified
• Research Discipline: Angiogenesis, Apoptosis, Cancer, Cancer Stem Cells, Chromatin Research, Embryonic Stem Cell Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Transcription Factors and Regulators
• Gene ID (Entrez): 2034.0
• Target Species: Human
• Isotype: IgG