Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HIF-2 alpha/EPAS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258653

Catalog No. NBP258653

Add to cart



HIF-2 alpha/EPAS1 Polyclonal antibody specifically detects HIF-2 alpha/EPAS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.


HIF-2 alpha/EPAS1
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Basic-helix-loop-helix-PAS protein MOP2, BHLHE73, bHLHe73ECYT4, Class E basic helix-loop-helix protein 73, endothelial PAS domain protein 1, endothelial PAS domain-containing protein 1, EPAS-1, HIF-1alpha-like factor, HIF-2 alpha, HIF2A, hif2a angiogenesis, HIF2AHIF-2-alpha, HLFHIF-1-alpha-like factor, hypoxia-inducible factor 2 alpha, Hypoxia-inducible factor 2-alpha, Member of PAS protein 2, MOP2HIF2-alpha, PASD2PAS domain-containing protein 2
100 ul
Angiogenesis, Cancer, Chromatin Research, HIF Target Genes, Hypoxia, Transcription Factors and Regulators
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG
Affinity purified
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only