Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HIRIP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | HIRIP3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HIRIP3 Polyclonal specifically detects HIRIP3 in Human samples. It is validated for Western Blot.Specifications
HIRIP3 | |
Polyclonal | |
Rabbit | |
Q9BW71 | |
8479 | |
Synthetic peptides corresponding to HIRIP3(HIRA interacting protein 3) The peptide sequence was selected from the middle region of HIRIP3. Peptide sequence RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
HIRA interacting protein 3, HIRA-interacting protein 3 | |
HIRIP3 | |
IgG | |
61 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title