Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HISPPD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HISPPD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154642
|
Novus Biologicals
NBP154642 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
HISPPD1 Polyclonal specifically detects HISPPD1 in Human samples. It is validated for Western Blot.Specifications
| HISPPD1 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| O43314 | |
| 23262 | |
| Synthetic peptides corresponding to HISPPD1(histidine acid phosphatase domain containing 1) The peptide sequence was selected from the middle region of HISPPD1. Peptide sequence SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| diphosphoinositol pentakisphosphate kinase 2FLJ21506, EC 2.7.4.21, EC 2.7.4.24, HISPPD1histidine acid phosphatase domain containing 1, Histidine acid phosphatase domain-containing protein 1, hsVIP2, inositol heptaphosphate kinase 2, inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2, InsP6 and PP-IP5 kinase 2, KIAA0433FLJ23463, VIP1 homolog 2, VIP2IP7K2 | |
| PPIP5K2 | |
| IgG | |
| Affinity Purified | |
| 138 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title