Histamine H2R Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP186082

Catalog No. NBP186082

Description

Histamine H2R Polyclonal specifically detects Histamine H2R in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Histamine H2R
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: gastric receptor 1, Gastric receptor I, H2R, HH2R, histamine H2 receptor, histamine receptor H2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HRH2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
• Quantity: 0.1 mL
• Research Discipline: GPCR, Stem Cell Markers
• Gene ID (Entrez): 3274
• Target Species: Human
• Isotype: IgG

For Research Use Only