Histone Deacetylase 2/HDAC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB406224	Novus Biologicals NBP18710925UL	25 μL
NBP187109	Novus Biologicals NBP187109	0.1 mL

Description

Histone Deacetylase 2/HDAC2 Polyclonal specifically detects Histone Deacetylase 2/HDAC2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: Histone Deacetylase 2/HDAC2
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Accession No.: Q92769
• Gene ID (Entrez): 3066
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 55 kDa

• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Breast Cancer, Cancer, Chromatin Research, Epigenetics, Histone Deacetylases, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.5.1.98, HD2, histone deacetylase 2, RPD3, transcriptional regulator homolog RPD3, YAF1, YY1-associated factor 1
• Gene Symbols: HDAC2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only