Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Histone H2AY/macroH2A.1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $501.50
Specifications
| Antigen | Histone H2AY/macroH2A.1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15301820
|
Novus Biologicals
NBP15301820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP153018
|
Novus Biologicals
NBP153018 |
100 μL |
Each for $501.50
|
|
|||||
Description
Histone H2AY/macroH2A.1 Polyclonal specifically detects Histone H2AY/macroH2A.1 in Human samples. It is validated for Western Blot.Specifications
| Histone H2AY/macroH2A.1 | |
| Polyclonal | |
| Rabbit | |
| core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1 | |
| H2AFY | |
| IgG | |
| 41 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 9555 | |
| Synthetic peptides corresponding to macroH2A.1. The peptide sequence was selected from the N terminal of macroH2A.1. Peptide sequence MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title