Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HIV-1 Gag p24 Antibody (7F4), mFluor Violet 500 SE, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP241339MFV500
Description
HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISASpecifications
| HIV-1 Gag p24 | |
| Monoclonal | |
| mFluor Violet 500 SE | |
| 50mM Sodium Borate | |
| Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
| 0.1 mL | |
| Infections (Virus Bacteria and Parasites) | |
| 155030 | |
| Store at 4C in the dark. | |
| IgG1 |
| Western Blot, ELISA | |
| 7F4 | |
| Western Blot, ELISA | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Virus | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction