Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HIV-1 Gag p24 Antibody, PerCP, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP241214PCP
Description
HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISASpecifications
| HIV-1 Gag p24 | |
| Polyclonal | |
| Western Blot, ELISA | |
| Rabbit | |
| Peptide affinity purified | |
| RUO | |
| Primary | |
| Virus | |
| Purified |
| Western Blot, ELISA | |
| PerCP | |
| PBS | |
| Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
| 0.1 mL | |
| Infections (Virus Bacteria and Parasites) | |
| 155030 | |
| Store at 4C in the dark. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction