Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HLA DMA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255086
Description
HLA DMA Polyclonal specifically detects HLA DMA in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
HLA DMA | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
class II histocompatibility antigen, M alpha chain, D6S222E, DMA, HLA class II histocompatibility antigen, DM alpha chain, major histocompatibility complex, class II, DM alpha, MHC class II antigen DMA, Really interesting new gene 6 protein, RING6HLADM | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
HLA-DMA | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENV | |
100 μL | |
Asthma, Diabetes Research, Immunology | |
3108 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction