Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HLA F Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | HLA F |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HLA F Polyclonal specifically detects HLA F in Human samples. It is validated for Western Blot.Specifications
| HLA F | |
| Polyclonal | |
| Rabbit | |
| Q5JQI8 | |
| 3134 | |
| Synthetic peptides corresponding to HLA-F (major histocompatibility complex, class I, F) The peptide sequence was selected from the N terminal of HLA-F. Peptide sequence PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| alpha chain F, HLA class I molecule, HLA F antigen, HLA-5.4, HLAFHLA-CDA12, Leukocyte antigen F, major histocompatibility complex, class I, F, MHC class I antigen F, MHC class Ib antigen | |
| HLA-F | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title