Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HLA F Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HLA F |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159524
|
Novus Biologicals
NBP159524 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
HLA F Polyclonal specifically detects HLA F in Human samples. It is validated for Western Blot.Specifications
| HLA F | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| alpha chain F, HLA class I molecule, HLA F antigen, HLA-5.4, HLAFHLA-CDA12, Leukocyte antigen F, major histocompatibility complex, class I, F, MHC class I antigen F, MHC class Ib antigen | |
| HLA-F | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5JQI8 | |
| 3134 | |
| Synthetic peptides corresponding to HLA-F (major histocompatibility complex, class I, F) The peptide sequence was selected from the N terminal of HLA-F. Peptide sequence PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title