Learn More
Invitrogen™ HMG4 Monoclonal Antibody (8H9)
Mouse Monoclonal Antibody
Supplier: Invitrogen™ MA536241
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human Jurkat whole cell, human CACO-2 whole cell, human 293T whole cell, human THP-1 whole cell, human HepG2 whole cell, human MCF-7 whole cell, rat brain tissue, rat lung tissue, mouse kidney tissue, mouse brain tissue, mouse lung tissue, mouse ovary tissue. ICC/IF: Hela cell. Flow: Hela cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
HMGB3 belongs to the high mobility group protein superfamily. Like HMG1 and HMG2, HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of the HMG box subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly and transcription.
Specifications
HMG4 | |
Monoclonal | |
500 μg/mL | |
PBS with 4mg trehalose and 0.05mg sodium azide | |
O15347, O54879 | |
HMGB3 | |
A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG2b |
Flow Cytometry, Western Blot, Immunocytochemistry | |
8H9 | |
Unconjugated | |
HMGB3 | |
high mobility group box 3; high mobility group protein 1; high mobility group protein 2a; High mobility group protein 4; high mobility group protein B1; high mobility group protein B3; high mobilty group protein 2A; high-mobility group (nonhistone chromosomal) protein 4; high-mobility group protein 4; HMG-1; HMG2a; HMG-2a; HMG4; HMG-4; HMGB1; Hmgb3; HMGB3 transcript variant 1/2; MGC90319; RGD1564407; Unknown (protein for MGC:133786) | |
Mouse | |
Affinity chromatography | |
RUO | |
15354, 305373, 3149 | |
-20°C | |
Lyophilized |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.