Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIMA536241

Invitrogen™ HMG4 Monoclonal Antibody (8H9)
GREENER_CHOICE

Catalog No. PIMA536241
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA536241 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIMA536241 Supplier Invitrogen™ Supplier No. MA536241
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human Jurkat whole cell, human CACO-2 whole cell, human 293T whole cell, human THP-1 whole cell, human HepG2 whole cell, human MCF-7 whole cell, rat brain tissue, rat lung tissue, mouse kidney tissue, mouse brain tissue, mouse lung tissue, mouse ovary tissue. ICC/IF: Hela cell. Flow: Hela cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

HMGB3 belongs to the high mobility group protein superfamily. Like HMG1 and HMG2, HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of the HMG box subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly and transcription.
TRUSTED_SUSTAINABILITY

Specifications

Antigen HMG4
Applications Flow Cytometry, Western Blot, Immunocytochemistry
Classification Monoclonal
Clone 8H9
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene HMGB3
Gene Accession No. O15347, O54879
Gene Alias high mobility group box 3; high mobility group protein 1; high mobility group protein 2a; High mobility group protein 4; high mobility group protein B1; high mobility group protein B3; high mobilty group protein 2A; high-mobility group (nonhistone chromosomal) protein 4; high-mobility group protein 4; HMG-1; HMG2a; HMG-2a; HMG4; HMG-4; HMGB1; Hmgb3; HMGB3 transcript variant 1/2; MGC90319; RGD1564407; Unknown (protein for MGC:133786)
Gene Symbols HMGB3
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 15354, 305373, 3149
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.