Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ HMGB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579373

Catalog No. PIPA579373


Only null left
Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, rat brain tissue, mouse brain tissue, mouse RAW264.7 whole cell. IHC: mouse intestine tissue, mouse liver tissue, rat intestine tissue, rat liver tissue, human mammary cancer tissue, human placenta tissue,. ICC/IF: U20S cell, A431 cell. Flow: THP-1 cell.

HMGB1 (High-mobility group box-1) protein was originally described as a nuclear non-histone DNA binding chromosomal protein. However, recent studies indicate that damaged, necrotic cells liberate HMGB1 into the extracellular milieu where it functions as a proinflammatory cytokine. Mouse HMGB1 is expressed as a 215 amino acid single chain polypeptide containing three domains: two tandem-linked positively charged DNA-binding domains (HMG box A, aa 9-79; and box B, aa 89-162), and a negatively charged 30 aa C-terminal acidic tail region. Residues 28 - 44 and 180 - 185 contain a nuclear localization signal (NLS). The cytokine activity of HMGB1 is contained in the B box, while the A box is associated with the helix-loop-helix domain of transcription factors. HMGB1 acts both as an inflammatory mediator that promotes monocyte migration and cytokine secretion, as well as a mediator of T cell-dendritic cell interaction. HMGB1 is secreted and acts to transduce cellular signals through its high affinity receptor, RAGE and possibly, TLR2 and TLR4. HMGB1 is highly conserved and ubiquitous in the nuclei and cytoplasm of nearly all cell types, is a necessary and sufficient mediator of inflammation during sterile and infection-associated responses. HMGB1 also act as DNA nuclear binding protein that has recently been shown to be an early trigger of sterile inflammation in animal models of trauma-hemorrhage via the activation of the Toll-like receptor 4 (TLR4) and the receptor for the advanced glycation endproducts (RAGE). Moreover, HMGB1 is reported that the level of HMGB1 is elevated during sterile tissue injury, infection, lethal endotoxemia or sepsis, collagen-induced arthritis, and ischemia-reperfusion induced tissue injury.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

HMGB1
Polyclonal
Unconjugated
Hmgb1
Ac2-008; amphoterin; Amphoterin antibody; DEF; DKFZp686A04236; Heparin-binding protein p30; high mobility group 1; high mobility group 1 protein; high mobility group box 1; high mobility group protein 1; High mobility group protein B1; high mobility group protein HMG1; high-mobility group (nonhistone chromosomal) protein 1; high-mobility group box 1; high-mobility-group protein; Hmg1; HMG-1; HMG3; HMG3 antibody; hmgb 1; HMGB1; hmgb-1; HMGB1 protein; hypothetical protein; non-histone protein HMG1; p30; RCJMB04_15a21; RP11-550P23.1; SBP-1; Sulfoglucuronyl carbohydrate binding protein; unnamed protein product
Rabbit
Antigen affinity chromatography
RUO
15289, 25459, 3146
-20°C
Lyophilized
Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
500 μg/mL
PBS with 4mg trehalose and 0.05mg sodium azide
P09429, P63158, P63159
Hmgb1
A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.