Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HMX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17937120UL
Description
HMX2 Polyclonal specifically detects HMX2 in Human samples. It is validated for Western Blot.Specifications
HMX2 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_005510 | |
HMX2 | |
Synthetic peptide directed towards the middle region of human HMX2The immunogen for this antibody is HMX2. Peptide sequence SPSHSDFKEEKERLLPAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRS. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
H6 family homeobox 2, H6 homeo box 2, H6L, homeo box (H6 family) 2, homeobox (H6 family) 2, Homeobox protein H6 family member 2, homeobox protein HMX2, NKX5-2 | |
Rabbit | |
Affinity Purified | |
RUO | |
3167 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction