Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HMX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	HMX2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP1793720 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17937120UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP179371 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP179371	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

HMX2 Polyclonal specifically detects HMX2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	HMX2
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_005510
Gene ID (Entrez)	3167
Immunogen	Synthetic peptide directed towards the middle region of human HMX2The immunogen for this antibody is HMX2. Peptide sequence SPSHSDFKEEKERLLPAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRS.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	H6 family homeobox 2, H6 homeo box 2, H6L, homeo box (H6 family) 2, homeobox (H6 family) 2, Homeobox protein H6 family member 2, homeobox protein HMX2, NKX5-2
Gene Symbols	HMX2
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

HMX2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents