Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HNRPDL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | HNRPDL |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HNRPDL Polyclonal specifically detects HNRPDL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
HNRPDL | |
Polyclonal | |
Rabbit | |
Human | |
O14979 | |
9987 | |
This antibody was developed against a recombinant protein corresponding to amino acids: DSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKM | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
A+U-rich element RNA binding factor, AU-rich element RNA-binding factor, heterogeneous nuclear ribonucleoprotein D-like, HNRNP, hnRNP DL, hnRNP D-like, JKTBP2, JKTBPJKT41-binding protein, laAUF1, Protein laAUF1 | |
HNRPDL | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title