Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HNRPLL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | HNRPLL |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HNRPLL Polyclonal specifically detects HNRPLL in Human samples. It is validated for Western Blot.Specifications
HNRPLL | |
Polyclonal | |
Rabbit | |
Q8WVV9 | |
92906 | |
Synthetic peptides corresponding to HNRPLL(heterogeneous nuclear ribonucleoprotein L-like) The peptide sequence was selected from the N terminal of HNRPLL. Peptide sequence MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
heterogeneous nuclear ribonucleoprotein L-like, hnRNPLL, SRRF, stromal RNA regulating factor, Stromal RNA-regulating factor | |
HNRPLL | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title