Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Homez Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Homez |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
Homez Polyclonal specifically detects Homez in Mouse samples. It is validated for Western Blot.Specifications
Homez | |
Polyclonal | |
Purified | |
RUO | |
homeobox and leucine zipper encoding, homeobox and leucine zipper protein Homez, KIAA1443Homeodomain leucine zipper-containing factor | |
HOMEZ | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
NP_898997 | |
57594 | |
Synthetic peptide directed towards the N terminal of mouse HOMEZ. Peptide sequence LSPLAPSEQPTHMKGLKVEPEEPSQVSQLPLNHQNAKEPLMMGSRTFSHQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title