Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HOXA9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310527100UL
Description
HOXA9 Polyclonal specifically detects HOXA9 in Human samples. It is validated for Western Blot.Specifications
HOXA9 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ABD-B, homeo box A9, homeobox A9, Homeobox protein Hox-1G, homeobox protein Hox-A9, homeobox protein HOXA9, homeodomain protein HOXA9, HOX1, HOX1.7, HOX1GMGC1934 | |
The immunogen is a synthetic peptide directed towards the middle region of human HOXA9 (NP_689952). Peptide sequence KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE | |
100 μg | |
Cancer | |
3205 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction