Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Hoxb3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen Hoxb3
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123626
View Documents
Novus Biologicals
NBP30936225UL
25 μg
Each for $106.19
Add to cart
 
NB123625
View Documents
Novus Biologicals
NBP309362100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

Hoxb3 Polyclonal antibody specifically detects Hoxb3 in Human samples. It is validated for Western Blot
Specifications

Specifications

Hoxb3
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
3213
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
homeo box 2G, homeobox B3, Homeobox protein Hox-2.7, Homeobox protein Hox-2G, homeobox protein Hox-B3, HOX2, Hox-2.7, HOX2Ghomeo box B3
The immunogen is a synthetic peptide directed towards the middle region of human Hoxb3 (NP_002137). Peptide sequence SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit