Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HOXB5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310906100UL
Description
HOXB5 Polyclonal specifically detects HOXB5 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
HOXB5 | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
HHO.C10, homeo box 2A, homeo box B5, homeobox B5, Homeobox protein HHO.C10, Homeobox protein Hox-2A, homeobox protein Hox-B5, Homeobox protein Hu-1, Hox2.1, HOX2AHOX2, HU-1 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5 (NP_002138). Peptide sequence MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
3215 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction