Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HOXD13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | HOXD13 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence, Immunoassay |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HOXD13 Polyclonal specifically detects HOXD13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Microarray.Specifications
HOXD13 | |
Polyclonal | |
Rabbit | |
Human | |
BDSD, homeo box 4I, homeo box D13, homeobox D13, Homeobox protein Hox-4I, homeobox protein Hox-D13, HOX4IBDE, SPD | |
HOXD13 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence, Immunoassay | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
3239 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCTKDQPQGSHFWKSSFPG | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title