Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ HPa1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579393
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579393 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579393 Supplier Invitrogen™ Supplier No. PA579393
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Liver Tissue, Human Placenta Tissue, A549 whole cell.

Stem cells offer a therapeutic promise for many diseases. In the case of diabetes, stem cells offer the promise that beta cells may be generated ex vivo for the possible transplantation and cure of Type I diabetes (Couri CE, et al. ). For this to happen, stem cells will need to be isolated and expanded, they will need to be differentiated toward the beta cell lineage, and the differentiated cell progeny used for transplantation may need to be isolated from complex cell mixtures following differentiation. Appropriate markers targeting cell surface molecules on developing and mature pancreatic cells will be required for such research.
TRUSTED_SUSTAINABILITY

Specifications

Antigen HPa1
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene HPSE
Gene Accession No. Q71RP1, Q9Y251
Gene Alias Endo-glucoronidase; endoglycosidase heparanase; HEP; Heparanase; Heparanase 50 kDa subunit; Heparanase 8 kDa subunit; Heparanase-1; heparanase-like; Hpa; HPA1; HPR1; HPSE; HPSE1; HSE1
Gene Symbols HPSE
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10855, 64537
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.