HPCL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23787725UL

Catalog No. NB436387

Description

HPCL Polyclonal specifically detects HPCL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HPCL
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q9UJ83
• Gene Symbols: HACL1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPISMAETSAVCTAASVIRNAKQPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 1600020H07Rik, 2,2-HPCL, 2-hydroxyacyl-CoA lyase 1, 2-hydroxyphytanoyl-CoA lyase2-hydroxyphytanol-CoA lyase, EC 4.1, HPCL, PHYH2FLJ55041, Phytanoyl-CoA 2-hydroxylase 2, phytanoyl-CoA hydroxylase 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26061
• Target Species: Human
• Isotype: IgG