HPDL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179857

Catalog No. NBP179857

Description

HPDL Polyclonal specifically detects HPDL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HPDL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 4-hydroxyphenylpyruvate dioxygenase-like, 4-hydroxyphenylpyruvate dioxygenase-like protein, EC 1.13, GLOXD1,4-HPPD-L, glyoxalase domain containing 1, Glyoxalase domain-containing protein 1, MGC15668, RP4-534D1.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_116145
• Gene Symbols: HPDL
• Immunogen: Synthetic peptide directed towards the C terminal of human HPDLThe immunogen for this antibody is HPDL. Peptide sequence GPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAAGH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84842
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.