Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HPDL Antibody, Novus Biologicals™

HPDL Antibody, Novus Biologicals™
SDP

Catalog No. NBP17985720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17985720 20 μL
NBP179857 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17985720 Supplier Novus Biologicals Supplier No. NBP17985720UL

Description

Rabbit Polyclonal Antibody

HPDL Polyclonal specifically detects HPDL in Human samples. It is validated for Western Blot.

Specifications

Antigen HPDL
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_116145
Gene Alias 4-hydroxyphenylpyruvate dioxygenase-like, 4-hydroxyphenylpyruvate dioxygenase-like protein, EC 1.13, GLOXD1,4-HPPD-L, glyoxalase domain containing 1, Glyoxalase domain-containing protein 1, MGC15668, RP4-534D1.1
Gene Symbols HPDL
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human HPDLThe immunogen for this antibody is HPDL. Peptide sequence GPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAAGH.
Molecular Weight of Antigen 39 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84842
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.