Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HPDL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17985720UL
Description
HPDL Polyclonal specifically detects HPDL in Human samples. It is validated for Western Blot.Specifications
HPDL | |
Polyclonal | |
Western Blot 1:1000 | |
NP_116145 | |
HPDL | |
Synthetic peptide directed towards the C terminal of human HPDLThe immunogen for this antibody is HPDL. Peptide sequence GPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAAGH. | |
Affinity Purified | |
RUO | |
84842 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
4-hydroxyphenylpyruvate dioxygenase-like, 4-hydroxyphenylpyruvate dioxygenase-like protein, EC 1.13, GLOXD1,4-HPPD-L, glyoxalase domain containing 1, Glyoxalase domain-containing protein 1, MGC15668, RP4-534D1.1 | |
Rabbit | |
39 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction