Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HPDL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | HPDL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179857
|
Novus Biologicals
NBP179857 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP17985720
|
Novus Biologicals
NBP17985720UL |
20 μL | N/A | N/A | N/A | ||||
Description
HPDL Polyclonal specifically detects HPDL in Human samples. It is validated for Western Blot.Specifications
| HPDL | |
| Polyclonal | |
| Rabbit | |
| NP_116145 | |
| 84842 | |
| Synthetic peptide directed towards the C terminal of human HPDLThe immunogen for this antibody is HPDL. Peptide sequence GPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAAGH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 4-hydroxyphenylpyruvate dioxygenase-like, 4-hydroxyphenylpyruvate dioxygenase-like protein, EC 1.13, GLOXD1,4-HPPD-L, glyoxalase domain containing 1, Glyoxalase domain-containing protein 1, MGC15668, RP4-534D1.1 | |
| HPDL | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title