Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HRP-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$336.16 - $690.48
Specifications
| Antigen | HRP-2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HRP-2 Polyclonal specifically detects HRP-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| HRP-2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| HDGF Like 2, HDGF2, HDGF-2, HDGFL2, HDGF-Related Protein 2, HDGFRP2, Hepatoma-derived growth factor 2, Hepatoma-Derived Growth Factor Related Protein 2, Hepatoma-Derived Growth Factor-Related Protein 2, HRP2 | |
| HDGFL2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 84717 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KVDSPDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKV | |
| Primary | |
| Specificity of human HRP-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title