Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HS747E2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | HS747E2A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HS747E2A Polyclonal specifically detects HS747E2A in Human samples. It is validated for Western Blot.Specifications
HS747E2A | |
Polyclonal | |
Rabbit | |
Human | |
bK747E2.1, chromosome 22 open reading frame 31, HS747E2A, hypothetical protein LOC25770 | |
C22ORF31 | |
IgG | |
33 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_056185 | |
25770 | |
Synthetic peptide directed towards the N terminal of human C22orf31. Peptide sequence ASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQAR. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title