Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSD11B2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23795425UL
Description
HSD11B2 Polyclonal specifically detects HSD11B2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
HSD11B2 | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
P80365 | |
HSD11B2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: SDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPG | |
25 μL | |
Stem Cell Markers | |
3291 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
AME, corticosteroid 11-beta-dehydrogenase isozyme 2,11-beta-HSD2, EC 1.1.1, EC 1.1.1.-, HSD11KAME1, HSD2,11-DH2, hydroxysteroid (11-beta) dehydrogenase 2, NAD-dependent 11-beta-hydroxysteroid dehydrogenase, SDR9C3, short chain dehydrogenase/reductase family 9C member 3,11-beta-hydroxysteroid dehydrogenase type 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction