Learn More
Invitrogen™ HSD11B2 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA579399
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat kidney tissue, mouse kidney tissue, human placenta tissue. IHC: Mouse Pancreas tissue, Rat Pancreas tissue, Human Placenta tissue IHC-F: human placenta tissue, mouse kidney tissue, rat kidney tissue.
There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.
Specifications
HSD11B2 | |
Polyclonal | |
Unconjugated | |
HSD11B2 | |
11(beta)-HSD2; 11-beta-HSD; 11-beta-HSD type II; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-beta-hydroxysteroid dehydrogenase type II; 11-DH2; 11-HSD type II; 11HSD2; AME; AME1; corticosteroid 11-beta-dehydrogenase isozyme 2; -HSD11 type II; HSD11B2; HSD11K; HSD2; hydroxysteroid (11-beta) dehydrogenase 2; hydroxysteroid 11-beta dehydrogenase 2; Hydroxysteroid dehydrogenase, 11 beta type 2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; SDR9C3; Short chain dehydrogenase/reductase family 9C member 3 | |
Rabbit | |
Antigen Affinity Chromatography | |
RUO | |
15484, 25117, 3291 | |
-20°C | |
Lyophilized |
Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
P50233, P51661, P80365 | |
HSD11B2 | |
A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.