Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSD17B4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
$416.50 - $682.00
Specifications
Antigen | HSD17B4 |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
HSD17B4 Polyclonal specifically detects HSD17B4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
HSD17B4 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3295 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
Polyclonal | |
Rabbit | |
Human, Mouse, Rat | |
12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase, 7-alpha, D-bifunctional protein, EDH17B4, hydroxysteroid (17-beta) dehydrogenase 4, MPF-2, peroxisomal, peroxisomal multifunctional enzyme type 2,17-beta-HSD IV, peroxisomal multifunctional protein 2,17beta-estradiol dehydrogenase type IV, short chain dehydrogenase/reductase family 8C, member 1,3-alpha | |
HSD17B4 | |
IgG | |
Affinity Purified | |
Specificity of human HSD17B4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title