Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hsd3b5 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$502.00
Specifications
| Antigen | Hsd3b5 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Hsd3b5 Polyclonal specifically detects Hsd3b5 in Mouse samples. It is validated for Western Blot.Specifications
| Hsd3b5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| 15496 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| The immunogen is a synthetic peptide directed towards the middle terminal region of mouse Hsd3b5 (NP_032321.2). Peptide sequence PKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLY | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title