Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSP20/HSPB6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23873925UL
Description
HSP20/HSPB6 Polyclonal specifically detects HSP20/HSPB6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
HSP20/HSPB6 | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
O14558 | |
HSPB6 | |
This antibody was developed against a recombinant protein corresponding to amino acids: MEIPVPVQPSWLRRASAPLPGLSAPGRLFD | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FLJ32389, Heat shock 20 kDa-like protein p20, heat shock protein beta-6, heat shock protein, alpha-crystallin-related, B6, Hsp20, HspB6 | |
Rabbit | |
Affinity Purified | |
RUO | |
126393 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction