HSP20/HSPB6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155523

Catalog No. NBP155523

Description

HSP20/HSPB6 Polyclonal specifically detects HSP20/HSPB6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HSP20/HSPB6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ32389, Heat shock 20 kDa-like protein p20, heat shock protein beta-6, heat shock protein, alpha-crystallin-related, B6, Hsp20, HspB6
• Host Species: Rabbit
• Molecular Weight of Antigen: 17 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish 77%, Sheep 79%, Equine 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O14558
• Gene Symbols: HSPB6
• Immunogen: Synthetic peptides corresponding to HSPB6(heat shock protein, alpha-crystallin-related, B6) The peptide sequence was selected from the middle region of HSPB6. Peptide sequence ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126393
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only