HSP40/DNAJB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238988

Catalog No. NBP238988

Description

HSP40/DNAJB1 Polyclonal specifically detects HSP40/DNAJB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HSP40/DNAJB1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P25685
• Gene Symbols: DNAJB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL
• Quantity: 0.1 mL
• Research Discipline: DNA Repair, Golgi Apparatus Markers, Membrane Trafficking and Chaperones
• Gene ID (Entrez): 3337
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DnaJ (Hsp40) homolog, subfamily B, member 1, DnaJ (Hsp40) homolog, subfmaily B, member 1, dnaJ homolog subfamily B member 1, DnaJ protein homolog 1, DNAJ1, hDj-1, HDJ1, Heat shock 40 kDa protein 1, heat shock 40kD protein 1, Heat shock protein 40, HSP40, HSPF1Hdj1, Human DnaJ protein 1, radial spoke 16 homolog B, RSPH16B, Sis1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.