Hsp70 interacting protein HIP Antibody (CL3708), Novus Biologicals™

Mouse Monoclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP261615	Novus Biologicals NBP261615	100 μL
NB393099	Novus Biologicals NBP26161525UL	25 μL

Description

Hsp70 interacting protein HIP Monoclonal specifically detects Hsp70 interacting protein HIP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Hsp70 interacting protein HIP
• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Host Species: Mouse
• Target Species: Human
• Gene ID (Entrez): 6767
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRA
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Clone: CL3708
• Classification: Monoclonal
• Form: Purified
• Research Discipline: Membrane Trafficking and Chaperones
• Gene Alias: AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein
• Gene Symbols: ST13
• Isotype: IgG1
• Purification Method: Protein A purified