HspA1L Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP156938	100 μL

Catalog No. NBP156938 Supplier Novus Biologicals Supplier No. NBP156938

Description

Rabbit Polyclonal Antibody

HspA1L Polyclonal antibody specifically detects HspA1L in Human, Rat samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: HspA1L
• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: P34931
• Gene Alias: heat shock 10kDa protein 1-like, Heat shock 70 kDa protein 1-Hom, Heat shock 70 kDa protein 1L, heat shock 70 kDa protein 1-like, heat shock 70kD protein-like 1, heat shock 70kDa protein 1-like, HSP70-1L, HSP70-HOM, HSP70T, hum70t
• Gene Symbols: HSPA1L
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to HSPA1L(heat shock 70kDa protein 1-like) The peptide sequence was selected from the C terminal of HSPA1L (NP_005518). Peptide sequence DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD.
• Molecular Weight of Antigen: 70 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Cancer
• Primary or Secondary: Primary
• Gene ID (Entrez): 3305
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Mouse: 85%.
• Reconstitution: Reconstitute with 50μL distilled water to a final antibody concentration of 1mg/mL.
• Target Species: Human, Rat, Invertebrate, Pig, Bovine, Canine, Equine, Goat
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only