HspA1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156938

Catalog No. NBP156938

Description

HspA1L Polyclonal antibody specifically detects HspA1L in Human, Rat samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: HspA1L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: heat shock 10kDa protein 1-like, Heat shock 70 kDa protein 1-Hom, Heat shock 70 kDa protein 1L, heat shock 70 kDa protein 1-like, heat shock 70kD protein-like 1, heat shock 70kDa protein 1-like, HSP70-1L, HSP70-HOM, HSP70T, hum70t
• Host Species: Rabbit
• Molecular Weight of Antigen: 70 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 3305
• Reconstitution: Reconstitute with 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation
• Gene Accession No.: P34931
• Gene Symbols: HSPA1L
• Immunogen: Synthetic peptides corresponding to HSPA1L(heat shock 70kDa protein 1-like) The peptide sequence was selected from the C terminal of HSPA1L (NP_005518). Peptide sequence DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Mouse: 85%.
• Target Species: Human, Rat, Invertebrate, Pig, Bovine, Canine, Equine, Goat
• Isotype: IgG

For Research Use Only