HspA1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192012

Catalog No. NBP192012

Description

HspA1L Polyclonal specifically detects HspA1L in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HspA1L
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: heat shock 10kDa protein 1-like, Heat shock 70 kDa protein 1-Hom, Heat shock 70 kDa protein 1L, heat shock 70 kDa protein 1-like, heat shock 70kD protein-like 1, heat shock 70kDa protein 1-like, HSP70-1L, HSP70-HOM, HSP70T, hum70t
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HSPA1L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KLYQGGCTGPACGTGYVPGRPATGPTIEEVD
• Quantity: 0.1 mL
• Research Discipline: Cancer
• Gene ID (Entrez): 3305
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only