Invitrogen™ HSPA2 Monoclonal Antibody (4A4)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA533000

Catalog No. PIMA533000

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human MDA-MB-231 whole cell, human COLO-320 whole cell, human PANC-1 whole cellhuman HT1080 whole cell, human MDA-MB-453 whole cell, human HepG2 whole cell, rat lung tissue, rat liver tissue, rat kidney tissue, rat testicular tissue, mouse lung tissue, mouse liver tissue, mouse kidney tissue, mouse testicular tissue, mouse RAW2467 whole cell. IHC: human lung cancer tissue. ICC/IF: PC-3 cell. Flow: PC-3 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Specifications

• Antigen: HSPA2
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P14659, P17156, P54652
• Gene Symbols: HSPA2
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG1

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Western Blot
• Clone: 4A4
• Conjugate: Unconjugated
• Gene: HSPA2
• Gene Alias: 70 kDa heat shock protein; 70kDa; Hcp70.2; Heat shock 70 kDa protein 2; Heat shock 70 kDa protein 3; heat shock 70kD protein 2; heat shock 70kDa protein 2; Heat shock protein; heat shock protein 2; heat shock protein 70.2; heat shock protein alpha 2; heat shock protein family A (Hsp70) member 2; heat shock protein, 70 kDa 2; heat shock-related 70 kDa protein 2; HSP; HSP70.2; HSP70.3; Hsp70-2; HSP70-3; HSP70A2; Hspa2; Hspt70; HST; Hst70; LOW QUALITY PROTEIN: heat shock-related 70 kDa protein 2; Testis-specific heat shock protein-related; testis-specific heat shock protein-related gene hst70
• Host Species: Mouse
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 15512, 3306, 60460
• Content And Storage: -20°C
• Form: Lyophilized