Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ HSPA2 Monoclonal Antibody (4A4)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA533000

Catalog No. PIMA533000


Only null left
Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human MDA-MB-231 whole cell, human COLO-320 whole cell, human PANC-1 whole cellhuman HT1080 whole cell, human MDA-MB-453 whole cell, human HepG2 whole cell, rat lung tissue, rat liver tissue, rat kidney tissue, rat testicular tissue, mouse lung tissue, mouse liver tissue, mouse kidney tissue, mouse testicular tissue, mouse RAW2467 whole cell. IHC: human lung cancer tissue. ICC/IF: PC-3 cell. Flow: PC-3 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

HSPA2
Monoclonal
500 μg/mL
PBS with 4mg trehalose and 0.05mg sodium azide
P14659, P17156, P54652
HSPA2
A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG1
Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Western Blot
4A4
Unconjugated
HSPA2
70 kDa heat shock protein; 70kDa; Hcp70.2; Heat shock 70 kDa protein 2; Heat shock 70 kDa protein 3; heat shock 70kD protein 2; heat shock 70kDa protein 2; Heat shock protein; heat shock protein 2; heat shock protein 70.2; heat shock protein alpha 2; heat shock protein family A (Hsp70) member 2; heat shock protein, 70 kDa 2; heat shock-related 70 kDa protein 2; HSP; HSP70.2; HSP70.3; Hsp70-2; HSP70-3; HSP70A2; Hspa2; Hspt70; HST; Hst70; LOW QUALITY PROTEIN: heat shock-related 70 kDa protein 2; Testis-specific heat shock protein-related; testis-specific heat shock protein-related gene hst70
Mouse
Affinity Chromatography
RUO
15512, 3306, 60460
-20°C
Lyophilized
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.