Learn More
Invitrogen™ HSPA2 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA579408
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human Hela whole cell, human A431 whole cell, rat kidney tissue, rat C6 whole cell, mouse NIH/3T3 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human lung cancer tissue. ICC/IF: PC-3 cell, PC-3 cell. Flow: PC-3 cell.
In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
Specifications
HSPA2 | |
Polyclonal | |
Unconjugated | |
HSPA2 | |
70 kDa heat shock protein; 70kDa; Hcp70.2; Heat shock 70 kDa protein 2; Heat shock 70 kDa protein 3; heat shock 70kD protein 2; heat shock 70kDa protein 2; Heat shock protein; heat shock protein 2; heat shock protein 70.2; heat shock protein alpha 2; heat shock protein family A (Hsp70) member 2; heat shock protein, 70 kDa 2; heat shock-related 70 kDa protein 2; HSP; HSP70.2; HSP70.3; Hsp70-2; HSP70-3; HSP70A2; Hspa2; Hspt70; HST; Hst70; LOW QUALITY PROTEIN: heat shock-related 70 kDa protein 2; Testis-specific heat shock protein-related; testis-specific heat shock protein-related gene hst70 | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
15512, 3306, 60460 | |
-20°C | |
Lyophilized |
Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
P14659, P17156, P54652 | |
HSPA2 | |
A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Safety and Handling
Your input is important to us. Please complete this form to provide feedback related to the content on this product.