Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579410

Invitrogen™ HSPA9 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579410
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579410 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579410 Supplier Invitrogen™ Supplier No. PA579410
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A549 whole cell, human Jurkat whole cell, human HepG2 whole cell, rat testis tissue, rat PC-12 whole cell, mouse testis tissue, mouse NIH/3T3 whole cell. IHC: human lung cancer tissue, human intestinal cancer tissue. ICC/IF: A549 cell. Flow: HL-60 cell IP: HepG2 cell.

The HSP70 family is composed of four highly conserved proteins: HSP70, HSC70, GRP75 and GRP78. These proteins serve a variety of roles. GRP75 expression is restricted to the mitochondrial matrix and aids in the translocation and folding of nascent polypeptide chains of both nuclear and mitochondrial origin. GRP75 and GRP78 are unresponsive to heat stress and are induced by glucose deprivation.
TRUSTED_SUSTAINABILITY

Specifications

Antigen HSPA9
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Immunoprecipitation, Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.01mg sodium azide
Gene HSPA9
Gene Accession No. P38646, P38647, P48721
Gene Alias 70 kDa heat shock protein; 74kDa; 75 kDa glucose-regulated protein; C3H-specific antigen; catecholamine-regulated protein 40; CRP40; CSA; epididymis secretory sperm binding protein Li 124m; EVPLS; GRP 75; GRP75; GRP-75; heat shock 70 kDa protein 9; heat shock 70 kDa protein 9B; heat shock 70kD protein 9B; heat shock 70kDa protein 9 (mortalin); heat shock 70kDa protein 9A; heat shock 70kDa protein 9B (mortalin-2); Heat shock protein; heat shock protein 9; heat shock protein 9A; heat shock protein cognate 74; heat shock protein family A (Hsp70) member 9; heat shock protein family A (Hsp70) member 9 S homeolog; heat shock protein, 74 kDa, A; heat shock protein, A; HEL-S-124m; Hsc74; HSP; Hsp74; Hsp74a; hspa9; hspa9.S; Hspa9a; hspa9-a; hspa9b; hspa9-b; hypothetical protein; I79_009139; MGC4500; mortalin; mortalin, perinuclear; mortalin2; mortalin-2; mot; MOT2; Mot-2; Mthsp70; mt-HSP70; MTHSP75; p66 MOT; p66-mortalin; pbp74; Peptide-binding protein 74; RCJMB04_2m8; SAAN; SIDBA4; stress-70 protein mitochondrial-like protein; stress-70 protein, mitochondrial; Stress-70 protein, mitochondrial-like protein; XELAEV_18020021mg
Gene Symbols HSPA9
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 15526, 291671, 3313
Target Species Human, Mouse, Rat, Monkey
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.