Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HspB11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP188332
Description
HspB11 Polyclonal specifically detects HspB11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
HspB11 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
C1orf41, heat shock protein beta-11, heat shock protein family B (small), member 11, Hspb11, HSPCO34, IFT25, intraflagellar transport 25 homolog, Placental protein 25, PP25chromosome 1 open reading frame 41 | |
Rabbit | |
Affinity Purified | |
RUO | |
51668 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
HSPB11 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:IDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQT | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction