Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSPC111 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | HSPC111 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HSPC111 Polyclonal specifically detects HSPC111 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
HSPC111 | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
HBV pre-S2 trans-regulated protein 3, HSPC111HSPC185, LOC51491, NOP15, NOP16 nucleolar protein homolog (yeast), nucleolar protein 16, nucleolar protein 16 homolog, nucleolar protein 16 homolog (yeast) | |
NOP16 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
51491 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVD | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title